DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Cdx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_034010.3 Gene:Cdx1 / 12590 MGIID:88360 Length:268 Species:Mus musculus


Alignment Length:223 Identity:71/223 - (31%)
Similarity:86/223 - (38%) Gaps:67/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 PASASAQFAQF--YQHATAAAS------------------------AVSAASAGAIGVDSLGNAC 344
            ||.|..|:..|  |.|...|.:                        ..||||...:......:..
Mouse    35 PAPAPPQYPDFAGYTHVEPAPAPPPTWAAPFPAPKDDWAAAYGPGPTASAASPAPLAFGPPPDFS 99

  Fly   345 TQPA-SGVMPG--AGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRG--RQT 404
            ..|| .|..||  |...|..|....|..|..|..:||    .|.|.....|.:|..|.:.  |..
Mouse   100 PVPAPPGPGPGILAQSLGAPGAPSSPGAPRRTPYEWM----RRSVAAAGGGGSGKTRTKDKYRVV 160

  Fly   405 YTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARR 469
            ||..|.||||||||::.|:|.||:.|:|..|.|||||:||||||||.|.:|              
Mouse   161 YTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERK-------------- 211

  Fly   470 DREEQEKMKAQETMKSAQQNKQVQQQQQ 497
                              .||:.|||||
Mouse   212 ------------------VNKKKQQQQQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 33/51 (65%)
Abdominal-A 456..478 CDD:289192 0/21 (0%)
Cdx1NP_034010.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..152 29/120 (24%)
Caudal_act 13..138 CDD:282574 25/106 (24%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P47902 157..178 12/20 (60%)
Homeobox 158..210 CDD:278475 33/51 (65%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:P47902 196..207 9/10 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..268 8/45 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.