DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Phox2a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_446321.2 Gene:Phox2a / 116648 RGDID:621323 Length:281 Species:Rattus norvegicus


Alignment Length:287 Identity:76/287 - (26%)
Similarity:107/287 - (37%) Gaps:58/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 YQHATAAASAVSAASAGAIGVDSLGNACTQPA----SGVMPGAGGAGGAGIADLPRYPWM----- 372
            |.:..:..|.|:|..|.|.|  ..| ||:||.    |.:.|....||       |..|.:     
  Rat     3 YSYLNSYDSCVAAMEASAYG--DFG-ACSQPGGFQYSPLRPAFPAAG-------PPCPALGSSNC 57

  Fly   373 ---TLTDWMGSPFERVVCGDFNGPNGC----PRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIE 430
               .|.|...:|:..|....|..|:|.    .:||.|.|:|..|..|||:.|...||.....|.|
  Rat    58 ALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREE 122

  Fly   431 IAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQ 495
            :|..:.|||.::::||||||.|.:|:.||............::.|...:.|              
  Rat   123 LALKIDLTEARVQVWFQNRRAKFRKQERAASAKGAAGATGAKKGEARCSSE-------------- 173

  Fly   496 QQQQQQQQQQQQQQHQQQQQQPQDHHSIIAHNPG-HLHHSVVGQNDLKLGLGMGVGVG--VGGIG 557
                     ....:.......|....|:....|. .|....:..:.|...||.|.|..  .|.:.
  Rat   174 ---------DDDSKESTCSPTPDSTASLPPPPPAPSLASPRLSPSPLPAALGSGPGPQPLKGALW 229

  Fly   558 PGIGGGLGGNLGMMSALDKSNHDLLKA 584
            .|:.||.||..|..:|      :||||
  Rat   230 AGVAGGGGGGPGAGAA------ELLKA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
Phox2aNP_446321.2 Homeobox 94..147 CDD:395001 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..219 12/96 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.