DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Gbx2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_446160.1 Gene:Gbx2 / 114500 RGDID:621866 Length:348 Species:Rattus norvegicus


Alignment Length:415 Identity:102/415 - (24%)
Similarity:140/415 - (33%) Gaps:138/415 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 LSAAL--QLQQQQHHISKLAAAAV---------ASHGH----------AHQQLLLTPPSAGNSQA 198
            :|||.  .|...|..:....|.::         .|.||          .::.::|.||       
  Rat     1 MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPP------- 58

  Fly   199 GDSSCSPSPSASGSSSLHRSLNDNSP---------GSASASASASAASSVAAAAAAAAAAASSSF 254
                 .|.|.|...::|..:|....|         |..|:.|...|.:|...|......:||...
  Rat    59 -----PPPPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQH 118

  Fly   255 --AIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFY 317
              |....|..|    .|...||     .|    |||.:...||    ....:..|...:..    
  Rat   119 QEAAAARKFAP----QPLPGGG-----NF----DKSEALQADT----EDGKAFLAKEGSLL---- 162

  Fly   318 QHATAAASAVSAASAGAI---GVD---------------SLGNACTQPASGVMPG---------- 354
              |.:||.||.|:..||:   |.|               ||.:.....:...:||          
  Rat   163 --AFSAAEAVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLPGQTAHKEEDPG 225

  Fly   355 --------AGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTL 411
                    :|||.|:..:                          .|.|    ||.|..:|..|.|
  Rat   226 HALEETPQSGGAAGSTTS--------------------------TGKN----RRRRTAFTSEQLL 260

  Fly   412 ELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEK 476
            |||||||...||:...|.:|||||.|:|.|:||||||||.|.|:    ||..|..::.. |....
  Rat   261 ELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKR----VKAGNANSKTG-EPSRN 320

  Fly   477 MKAQETMKSAQQNKQVQQQQQQQQQ 501
            .|....:........::.|.||.:|
  Rat   321 PKIVVPIPVHVSRFAIRSQHQQLEQ 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 31/51 (61%)
Abdominal-A 456..478 CDD:289192 4/21 (19%)
Gbx2NP_446160.1 Homeobox 250..304 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.