DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP013373

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_003436924.1 Gene:AgaP_AGAP013373 / 11175540 VectorBaseID:AGAP013373 Length:216 Species:Anopheles gambiae


Alignment Length:150 Identity:45/150 - (30%)
Similarity:61/150 - (40%) Gaps:56/150 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEI 463
            |:.||.|:..|...||.||..|.||...:|.|:|..|.|||.|||.||||||.|.||:       
Mosquito    20 RKPRQAYSAMQLERLEDEFQRNIYLNVNKRFELAQCLGLTETQIKTWFQNRRTKFKKQ------- 77

  Fly   464 NEQARRDREEQEKMK---------------------------------------AQETMKSA--- 486
             :.:|..||::::.:                                       ||.|::||   
Mosquito    78 -QDSRNKREQRQQAQLIAQWLFQPPQLGSIPLDGQLQPLPRLAALPVHRSSLALAQGTLQSALMA 141

  Fly   487 ------QQNKQVQQQQQQQQ 500
                  ..:..|||.|.||:
Mosquito   142 PYHLLPPTSLTVQQHQHQQR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 28/51 (55%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
AgaP_AGAP013373XP_003436924.1 Homeobox 22..75 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.