DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and CPHXL

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001342542.1 Gene:CPHXL / 105371346 HGNCID:51815 Length:405 Species:Homo sapiens


Alignment Length:180 Identity:40/180 - (22%)
Similarity:60/180 - (33%) Gaps:69/180 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SNTIAGSNTSNTNNSSSSPSSS----SNNNSNLNLSGGSLSPSHLSQHLGQSPHSPVSS------ 117
            |..:|..::.....:...|..:    .:..|..:.||.|.:...||.:..:..|.|.||      
Human   200 SQQVASQSSYLVTGTEKHPGCAMGYGGDTGSGHSGSGHSTAYHFLSYNSAECLHPPPSSVPYFHG 264

  Fly   118 ----------SSPFQQHHPQ----VQQQH---------LNHQQQQ----HL-HHQQQQHH----- 149
                      :|||...:.|    |::.|         |..|||.    || .|||.|::     
Human   265 ERTETKESQHASPFLLDYAQGAYGVKKDHCLCSFCLSLLGQQQQNDWQYHLQQHQQPQNYLEGMM 329

  Fly   150 ---------------HQYSSLSAALQLQ-----------QQQHHISKLAA 173
                           .|:||..:.||.|           |.||...::||
Human   330 LQEQLPMDSGPWDLGKQWSSAQSQLQSQLPQNNGKPLCSQLQHMSLQIAA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475
Abdominal-A 456..478 CDD:289192
CPHXLNP_001342542.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
HOX 28..82 CDD:197696
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..363 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.