DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_598793.2 Gene:Hoxb2 / 103889 MGIID:96183 Length:354 Species:Mus musculus


Alignment Length:246 Identity:70/246 - (28%)
Similarity:92/246 - (37%) Gaps:105/246 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 GSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGL 275
            |:|:|.|      |||...:....|..|......|           |.:..:|::.         
Mouse    59 GASTLQR------PGSQKQAGDGPALRSPPPLPVA-----------PPAPEFPWMK--------- 97

  Fly   276 SGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSL 340
                     |.||..:              |:.::|.       .:.|||:|.|:..|:      
Mouse    98 ---------EKKSTKK--------------PSQSAAS-------PSPAASSVRASEVGS------ 126

  Fly   341 GNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTY 405
                  |:.|  ||....||:|                                   .||.|..|
Mouse   127 ------PSDG--PGLPECGGSG-----------------------------------SRRLRTAY 148

  Fly   406 TRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
            |..|.||||||||||.||.|.||:|||..|.|||||:|:||||||||.|::
Mouse   149 TNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQ 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 37/51 (73%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
Hoxb2NP_598793.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..143 30/188 (16%)
Antp-type hexapeptide 92..97 1/4 (25%)
Homeobox 145..197 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.