DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxa1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_037207.2 Gene:Hoxa1 / 103690132 RGDID:11414885 Length:334 Species:Rattus norvegicus


Alignment Length:343 Identity:91/343 - (26%)
Similarity:123/343 - (35%) Gaps:101/343 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPSAGN--SQAGDSSCSPSPSASGSSSLHRSLND 221
            :|:....||           |.|.|.....|..::||  .....|||.||..|...|:.:     
  Rat    59 VQITSPHHH-----------HHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGAQNFSAPY----- 107

  Fly   222 NSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFT---- 282
               |....:..|..:......|.|..:...||         |.|.:|....|...|..|..    
  Rat   108 ---GPYGLNQEADVSGGYPPCAPAVYSGNLSS---------PMVQHHHHHQGYAGGTVGSPQYIH 160

  Fly   283 ---GLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNAC 344
               |.|.:|.:      :.:|.:...|..||.|                             .||
  Rat   161 HSYGQEHQSLA------LATYNNSLSPLHASHQ-----------------------------EAC 190

  Fly   345 TQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWM---GSPFERVVCGDF---NGPNGCPRRRGRQ 403
            ..|||....                |..|. |||   .:|.:....|::   ..||..     |.
  Rat   191 RSPASETSS----------------PAQTF-DWMKVKRNPPKTGKVGEYGYVGQPNAV-----RT 233

  Fly   404 TYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK-ELRAVKEINEQA 467
            .:|..|..|||||||||.||||.||:|||.:|.|.|.|:||||||||||.|| |...:..|:...
  Rat   234 NFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPAT 298

  Fly   468 RRDREEQEKMKAQETMKS 485
            ....:|:.:..::::..|
  Rat   299 PPGSDEKTEESSEKSSSS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 35/51 (69%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
Hoxa1NP_037207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..82 6/31 (19%)
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 74..202 36/195 (18%)
COG5576 175..>285 CDD:227863 54/160 (34%)
Antp-type hexapeptide 203..208 3/5 (60%)
Homeobox 232..284 CDD:278475 35/51 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..334 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.