DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxa3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001300749.1 Gene:Hoxa3 / 103690130 RGDID:1561431 Length:444 Species:Rattus norvegicus


Alignment Length:255 Identity:79/255 - (30%)
Similarity:101/255 - (39%) Gaps:72/255 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 ASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFA 314
            |::.||...|:. ||.   ||:..|..|:.    ....:|            |:..||||.|. .
  Rat    20 AANGFAYNASQQ-PYA---PSATLGTDGVE----YHRPAC------------SLQSPASAGAH-P 63

  Fly   315 QFYQHATAAASAVSAASAGAIGVDSLGN-----------------------------ACTQPASG 350
            :.::.:.|....:|...:...|   ||:                             |...|.|.
  Rat    64 KSHELSEACLRTLSGPPSQPPG---LGDPPLPPPPPQAAPPAPQPPQPPPQPPAPTPAAPPPPSS 125

  Fly   351 VMPGAGGAGG---AGIADLPR----------YPWM------TLTDWMGSPFERVVCGDFNGPNGC 396
            |.|.......   |..|..|.          :|||      |.....||.......||.:.|...
  Rat   126 VSPPQSANSNPTPASTAKSPLLNSPTVGKQIFPWMKESRQNTKQKTSGSSSGESCAGDKSPPGQA 190

  Fly   397 PRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
            ..:|.|..||..|.:|||||||||.||.|.||:|:|:.|.||||||||||||||||.||:
  Rat   191 SSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 37/51 (73%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
Hoxa3NP_001300749.1 COG5576 <182..309 CDD:227863 43/69 (62%)
Homeobox 196..249 CDD:395001 37/52 (71%)
DUF4074 379..442 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.