Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001300749.1 | Gene: | Hoxa3 / 103690130 | RGDID: | 1561431 | Length: | 444 | Species: | Rattus norvegicus |
Alignment Length: | 255 | Identity: | 79/255 - (30%) |
---|---|---|---|
Similarity: | 101/255 - (39%) | Gaps: | 72/255 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 250 ASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFA 314
Fly 315 QFYQHATAAASAVSAASAGAIGVDSLGN-----------------------------ACTQPASG 350
Fly 351 VMPGAGGAGG---AGIADLPR----------YPWM------TLTDWMGSPFERVVCGDFNGPNGC 396
Fly 397 PRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 37/51 (73%) |
Abdominal-A | 456..478 | CDD:289192 | 0/1 (0%) | ||
Hoxa3 | NP_001300749.1 | COG5576 | <182..309 | CDD:227863 | 43/69 (62%) |
Homeobox | 196..249 | CDD:395001 | 37/52 (71%) | ||
DUF4074 | 379..442 | CDD:404218 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |