DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxd11

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_008760183.3 Gene:Hoxd11 / 102553842 RGDID:7730597 Length:336 Species:Rattus norvegicus


Alignment Length:269 Identity:75/269 - (27%)
Similarity:104/269 - (38%) Gaps:75/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 PGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPS---------------SHG 273
            ||.....:...|....|||||||||||:...|:... :.|.....|.               .||
  Rat    91 PGGGGGGSGGYAPYYAAAAAAAAAAAAAEEAAMQRD-LLPPAGRRPDVLFKAPEPVCGAPGPPHG 154

  Fly   274 GLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHAT----------------- 321
            ..:..:.|                  |.::.........|.|||:.|.                 
  Rat   155 PAAAASNF------------------YSAVGRNGILPQGFDQFYEAAPGPPFAGPQPQPAPAPPQ 201

  Fly   322 ---AAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFE 383
               ||......|.||..|    |:.|::...|..|.....||.|..:             |.|.|
  Rat   202 PEGAADKGDPKAGAGGGG----GSPCSKATPGPEPKGAAEGGGGEGE-------------GPPGE 249

  Fly   384 RVVCGDFNGPNGCPR--RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWF 446
              ...:.:|....|:  |:.|..||::|..|||:||.||.|:.:.:|::::..|.||:||:||||
  Rat   250 --AGAEKSGGTVAPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWF 312

  Fly   447 QNRRMKLKK 455
            ||||||.||
  Rat   313 QNRRMKEKK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 28/51 (55%)
Abdominal-A 456..478 CDD:289192 75/269 (28%)
Hoxd11XP_008760183.3 DUF3528 26..187 CDD:403310 26/114 (23%)
Homeobox 267..321 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.