DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and evx2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002935724.3 Gene:evx2 / 100498260 XenbaseID:XB-GENE-852923 Length:502 Species:Xenopus tropicalis


Alignment Length:272 Identity:69/272 - (25%)
Similarity:100/272 - (36%) Gaps:72/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPS--------- 270
            :.|.|:....|....:.|..|.::|..|...|..|...|..|.:|.::..:..|.|         
 Frog    91 MERGLHSPGSGKRLPTVSDPAGNAVLEALEHAHHAGRLSPRITSSSLHGAIGEHHSKGKFEIESL 155

  Fly   271 ---------SHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASA 326
                     |:|.:||..     ..|..|:|.:....:..:..|....:                
 Frog   156 FGISHSTEESNGDISGAD-----RGKKLSQYPEVSKEADMNSDVEVGCA---------------- 199

  Fly   327 VSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFN 391
             ...|.|:|..:.|..:.....|.|....|.:..:||                        |..|
 Frog   200 -GLRSPGSINGNQLKESSKDSGSSVASTTGSSTPSGI------------------------GSLN 239

  Fly   392 G--PNGCPR------RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQN 448
            |  |.|...      ||.|..:||.|...|||||:..:|::|.||.|:|.||.|.|..||:||||
 Frog   240 GLNPVGSSSSAADQVRRYRTAFTREQIGRLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQN 304

  Fly   449 RRMKLKKELRAV 460
            ||||.|::..|:
 Frog   305 RRMKDKRQRLAM 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 29/51 (57%)
Abdominal-A 456..478 CDD:289192 1/5 (20%)
evx2XP_002935724.3 Homeobox 258..311 CDD:395001 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.