DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and mnx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002935225.2 Gene:mnx1 / 100496534 XenbaseID:XB-GENE-919890 Length:338 Species:Xenopus tropicalis


Alignment Length:386 Identity:92/386 - (23%)
Similarity:148/386 - (38%) Gaps:101/386 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 LLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAA 250
            |.:.||.        |..||....:..||...|.:.:.|...:.|......|.............
 Frog    13 LAIDPPK--------SQTSPLALVTSLSSSSLSNSGSPPSEHTDSLRTDTPSPPRTCGLVPKPGF 69

  Fly   251 SSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQ 315
            .||...|.:.|    :.||.:..|:...|.: |....|.|.........:.::|.|...    .|
 Frog    70 LSSHQHPINMM----ALHPQAAPGIPPQALY-GHPMYSYSAAAALAAGQHPALSYPYPQ----MQ 125

  Fly   316 FYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGS 380
            ...||......:. .|||...:|....|.|   :|:|             ||:            
 Frog   126 GAHHAHHPVDPIK-ISAGTFQLDQWLRAST---AGMM-------------LPK------------ 161

  Fly   381 PFERVVCGDFNGP------NGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTE 439
                  ..|||..      ..|  ||.|..:|..|.||||.:|..|.||:|.:|.|:|.:|.|||
 Frog   162 ------MADFNSQAQSNLLGKC--RRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTE 218

  Fly   440 RQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKM-------KAQETMKSAQQNKQV----- 492
            .|:||||||||||.|:.    |:..|||.:|.|:|::.       |..|.::..:.:..:     
 Frog   219 TQVKIWFQNRRMKWKRS----KKAKEQAVQDAEKQQRAGKGSCEEKCPEELQEDKNSYHLHPRGD 279

  Fly   493 ---------------QQQQQQQQQQQQQQQQQHQQQQQQPQDHHSI--------IAHNPGH 530
                           ::::.::.::::::::.|:::::  ..|||.        .:||.||
 Frog   280 PIKGNSRLVRDYSDSEEEEDEEDREEEEEEEGHREEKR--FYHHSSDCTSEEEESSHNKGH 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 30/51 (59%)
Abdominal-A 456..478 CDD:289192 7/28 (25%)
mnx1XP_002935225.2 Homeobox 180..234 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.