DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and drgx

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_004915967.1 Gene:drgx / 100493837 XenbaseID:XB-GENE-993712 Length:263 Species:Xenopus tropicalis


Alignment Length:129 Identity:42/129 - (32%)
Similarity:63/129 - (48%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 MGS-PFERVVCGDFNGPNGCPRRRGRQTYTRF--QTLE-LEKEFHFNHYLTRRRRIEIAHALCLT 438
            :|| ||......:|:  :|..||:.|:..|.|  |.|| ||..|...||.....|.|:|..:.||
 Frog    12 VGSPPFGAHAASEFD--DGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLT 74

  Fly   439 ERQIKIWFQNRRMKLKKELRAVKEINEQARRDREE----QEKMKAQETMKSAQQNKQVQQQQQQ 498
            |.::::||||||.|.:|..|...| .|.|:....|    ...:....|::..:..|:..:.||:
 Frog    75 EARVQVWFQNRRAKWRKTERGSCE-QEGAKESAPEVTTAGRNLSPSSTVEPVRGKKETLEAQQR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 24/54 (44%)
Abdominal-A 456..478 CDD:289192 5/25 (20%)
drgxXP_004915967.1 Homeobox 38..91 CDD:395001 23/52 (44%)
OAR 204..220 CDD:397759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.