DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and lmx1a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002934210.1 Gene:lmx1a / 100492433 XenbaseID:XB-GENE-481569 Length:380 Species:Xenopus tropicalis


Alignment Length:210 Identity:49/210 - (23%)
Similarity:89/210 - (42%) Gaps:33/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 DFNGP-NGCPRRRGRQTYTRFQTLE---LEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNR 449
            |..|| :|..::|.::..|...|.:   .:..|..:....|:.|..:|....|:.|.:::||||:
 Frog   179 DSKGPEDGKDQKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQ 243

  Fly   450 RMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQ--------VQQQQQQQQQQQQQQ 506
            |.|:||..|  ::..:|.::|::...::.:.:|..|:..:.:        :.|||....:|....
 Frog   244 RAKMKKLAR--RQQQQQQQQDQQNPSRIPSAQTHNSSSSSVEGIMNVFTTLPQQQLLSLEQNIYS 306

  Fly   507 QQQHQQ---QQQQPQDHHSIIAHNPG--HLHHSV----VGQNDLKLGLGMGVGVGVGGIGPGIGG 562
            ....||   ..|.|.||    .|..|  .|.|.:    ...|:|...|..|..:|      .|.|
 Frog   307 ADPFQQGLTPPQMPGDH----MHPYGGESLFHDIDSDDASLNNLSECLLPGPELG------SIQG 361

  Fly   563 GLGGNLGMMSALDKS 577
            .:|..:..:.::..|
 Frog   362 RVGNPIDRLYSMQNS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 14/54 (26%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
lmx1aXP_002934210.1 LIM1_Lmx1a 35..86 CDD:188756
LIM 94..148 CDD:351770
Homeobox 195..249 CDD:365835 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.