DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and uncx

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001305673.1 Gene:uncx / 100492016 XenbaseID:XB-GENE-920201 Length:483 Species:Xenopus tropicalis


Alignment Length:284 Identity:74/284 - (26%)
Similarity:117/284 - (41%) Gaps:61/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 VSNHPSSH--GGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAAS-- 325
            :..||.:.  |.:|||.||                              .:...:.|....||  
 Frog     6 ILEHPHAQFGGSMSGMVGF------------------------------PYPLGHHHVYELASHQ 40

  Fly   326 AVSAASAGAIGVDSLGN-ACTQPASGVMPGAGGAGGAGI-ADLPRYPWMTLTDWMGSPFERVVCG 388
            ..|||:|....:|.|.| :||  ||.:.|......|.|: .|..:|   .|:|        .:..
 Frog    41 LQSAAAAVPFSIDGLLNGSCT--ASVINPTPLLPSGCGLNGDSQQY---KLSD--------SIDP 92

  Fly   389 DFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKL 453
            |...| ||.|||.|..:|.:|..||||.|:.:||.....|..:|..|.|.|.::::||||||.|.
 Frog    93 DKESP-GCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKW 156

  Fly   454 KKELRAVKEINEQARRDRE---EQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQ 515
            :|:....|.....|.....   ..|.|..:|..:     |::::.::::::|:::..:...:.|.
 Frog   157 RKKENTKKGPGRPAHNSHPTTCSGEPMDPEEIAR-----KELEKMEKKKRKQEKKMLRNQNRLQH 216

  Fly   516 QPQDHHSIIAHNPGHLHHSVVGQN 539
            .|.|   :..|.|.....|.:.||
 Frog   217 SPGD---MSLHTPSSDSDSGLSQN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 22/51 (43%)
Abdominal-A 456..478 CDD:289192 3/24 (13%)
uncxNP_001305673.1 homeobox domain 101..160 26/58 (45%)
Homeobox 104..158 CDD:365835 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.