DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and pdx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002934065.1 Gene:pdx1 / 100490648 XenbaseID:XB-GENE-483331 Length:271 Species:Xenopus tropicalis


Alignment Length:131 Identity:55/131 - (41%)
Similarity:72/131 - (54%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 LPRYPWMTLT-------DWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYL 423
            || :|||..|       .|.|..:  ::..:.|       :|.|..|||.|.|||||||.||.|:
 Frog   118 LP-FPWMKSTKSHTWKGQWTGGSY--IMEQEEN-------KRTRTAYTRAQLLELEKEFLFNKYI 172

  Fly   424 TRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQAR-RDREEQEKMKAQETMKSAQ 487
            :|.||:|:|..|.||||.|||||||||||.|||     |..::.| .|.|:...:.:.:.:|...
 Frog   173 SRPRRVELAVMLNLTERHIKIWFQNRRMKWKKE-----EDKKRGRGSDPEQDSVVSSADVIKDEP 232

  Fly   488 Q 488
            |
 Frog   233 Q 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 36/51 (71%)
Abdominal-A 456..478 CDD:289192 5/22 (23%)
pdx1XP_002934065.1 Homeobox 150..204 CDD:365835 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.