DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and trhr3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002933212.1 Gene:trhr3 / 100489565 XenbaseID:XB-GENE-6492473 Length:404 Species:Xenopus tropicalis


Alignment Length:65 Identity:14/65 - (21%)
Similarity:25/65 - (38%) Gaps:20/65 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKFVFDSMLPKYPQFQPFISSHHLTTTPPNSSSAAVAAALAAAAASASASVSASSSSNNNSSNT 65
            :::.:|.:.||..||....:||.|. ..|.|                   |:..|...|.|::::
 Frog   221 IARILFMNPLPSNPQDLSRMSSKHY-GKPYN-------------------SIKLSGKGNKNTASS 265

  Fly    66  65
             Frog   266  265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475
Abdominal-A 456..478 CDD:289192
trhr3XP_002933212.1 7tmA_TRH-R 34..336 CDD:320126 14/65 (22%)
TM helix 1 35..61 CDD:320126
TM helix 2 68..93 CDD:320126
TM helix 3 105..135 CDD:320126
TM helix 4 148..169 CDD:320126
TM helix 5 195..224 CDD:320126 0/2 (0%)
TM helix 6 264..294 CDD:320126 0/2 (0%)
TM helix 7 304..329 CDD:320126
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.