DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and plppr4

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002933836.2 Gene:plppr4 / 100489346 XenbaseID:XB-GENE-976836 Length:721 Species:Xenopus tropicalis


Alignment Length:324 Identity:61/324 - (18%)
Similarity:93/324 - (28%) Gaps:105/324 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FDSMLPKYPQFQPFISSHHLTTTPPNSSSAAVAAALAAAAASASASVSASSSSNNNSS------- 63
            |.:.||:             ..||.....|...|.:.|:..||.:....|.....|.|       
 Frog   372 FSNTLPR-------------VHTPSLEDPARRNATIHASMDSARSKQLLSQWKTKNESRKLSLQV 423

  Fly    64 -NTIAGSNTSN--TNNSSSSPSSSSNN-------NSNLNLSGGSL-----------------SPS 101
             .|.||.:...  ...|||.|.....|       ||.|.|..||:                 |..
 Frog   424 IETEAGLSPQRIIEMRSSSEPVRVGVNGEHIGPGNSYLKLQPGSVPGCNNTGIPGGPRVSIQSRP 488

  Fly   102 HLSQ--HLGQSPHSPVSSSSP-------------------FQQHHPQVQQQHLNHQQQQHLHHQQ 145
            ..||  |:.:..|..:.::||                   .....|::.|.....:||..|....
 Frog   489 GSSQLVHIPEETHENILTTSPKCSSARSKWLKVAEKSVVCRSNSQPRIMQVIAMSKQQGMLQGSP 553

  Fly   146 QQHHHQYSSLSAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTP-------------PSAG--- 194
            :.......|.:.:::.:....| .......:.:|...::.::..|             |..|   
 Frog   554 KSSEGSTVSCTGSIRYKALTEH-EPTNIVRIEAHPENNRPIIQMPLEGEGSGSWKWKAPEKGTLR 617

  Fly   195 -----NSQAGDS-SCSPSPSASGSSSLHRSLNDNS--------------PGSASASASASAASS 238
                 |....|| ||.....:.|::...||..:|.              .||...|.:.|.|||
 Frog   618 QAYELNDLNRDSESCESLKDSFGTTERKRSNIENDHLLHGITTIRVTPVEGSEIGSETVSIASS 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475
Abdominal-A 456..478 CDD:289192
plppr4XP_002933836.2 PAP2_wunen 126..275 CDD:239479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.