DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxc5

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002936695.2 Gene:hoxc5 / 100487879 XenbaseID:XB-GENE-485672 Length:225 Species:Xenopus tropicalis


Alignment Length:264 Identity:84/264 - (31%)
Similarity:111/264 - (42%) Gaps:90/264 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 IPTSKMYPY-----VSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQ 315
            :|...|..|     ||..|||....||:       |.|.:..:....||..::.:|::.:|...:
 Frog    16 VPAYSMQSYGNYGSVSEVPSSRYCYSGL-------DLSITFPSPGSSNSLSALDMPSNPNANSER 73

  Fly   316 ------------------------FYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAG 356
                                    .|....|..|....:.    |::|:.   |:||... |..|
 Frog    74 PSCTVMGSSGHTVGRGEQSALNSGIYNQKAATTSLEERSK----GIESIK---TEPAQST-PQGG 130

  Fly   357 GAGGAGIADLPR-YPWMTL------TDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELE 414
            ..........|: |||||.      ||                     .:|.|.:|||:||||||
 Frog   131 QPQQQQQQQPPQIYPWMTKLHMSHETD---------------------GKRSRTSYTRYQTLELE 174

  Fly   415 KEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKA 479
            ||||||.|||||||||||:.|||.||||||||||||||.||:                  .|:|:
 Frog   175 KEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKD------------------TKVKS 221

  Fly   480 QETM 483
            :::|
 Frog   222 KDSM 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 44/51 (86%)
Abdominal-A 456..478 CDD:289192 1/21 (5%)
hoxc5XP_002936695.2 Homeobox 161..215 CDD:395001 44/53 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.