DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and zfhx4

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_012820690.1 Gene:zfhx4 / 100486096 XenbaseID:XB-GENE-957673 Length:3559 Species:Xenopus tropicalis


Alignment Length:353 Identity:76/353 - (21%)
Similarity:121/353 - (34%) Gaps:79/353 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 QQHHHQYSSLSAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPSAGNSQAGDSSCSP----- 205
            |:......||.|..|:..:.:          .|.|.|.     ||.:|..:.:|..|.:|     
 Frog  2305 QEDSQNEDSLDATDQIMPKTY----------LSFGQAD-----TPKAAPTASSGSGSSTPLIPSP 2354

  Fly   206 -------SPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYP 263
                   ||.....|...:.::             :.|||:|:....:|:||||......|:..|
 Frog  2355 RPEIDKISPKPDIPSEKPKQID-------------AIASSLASKLTQSASAASSDIQPSPSQQRP 2406

  Fly   264 YVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNS-------YQ-SMSVPASASAQFAQFYQHA 320
                 |...|..|..:..|.:..........::.||       || .....|..:.:..|.:|| 
 Frog  2407 -----PQQIGRPSSASQTTSVPSSPLPISITSLQNSLPPQLLQYQCDQCTIAFPTLELWQEHQH- 2465

  Fly   321 TAAASAVSAASAGAIGVDSLGNACTQPASGVMPG----AGGAGGAGIADLPRYPWMTLTDWMGSP 381
                ....||....|....|......|.....|.    ||...|..:|.:|....|:..:...|.
 Frog  2466 ----MHFLAAQNQFIHTQFLERPIDMPYMIFDPNNPLMAGQLLGGSVAHMPTQTGMSHANTSISL 2526

  Fly   382 FERVVCGDFNGPNGCPRRRG-------------RQTYTRFQTLELEKEFHFNHYLTRRRRIEIAH 433
            ..::   |....|.|..:.|             |.|.|..|...|.:::..:...||:....||.
 Frog  2527 KRKL---DEKDENNCSEKEGGNSGEDQHRDKRLRTTITPEQLEILYEKYLLDSNPTRKMLDHIAR 2588

  Fly   434 ALCLTERQIKIWFQNRRMKLKK-ELRAV 460
            .:.|.:|.:::||||.|.:.:| :.||:
 Frog  2589 EVGLKKRVVQVWFQNTRARERKGQFRAL 2616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 16/51 (31%)
Abdominal-A 456..478 CDD:289192 2/5 (40%)
zfhx4XP_012820690.1 C2H2 Zn finger 641..661 CDD:275368
C2H2 Zn finger 696..713 CDD:275368
C2H2 Zn finger 1372..1392 CDD:275371
C2H2 Zn finger 1400..1421 CDD:275371
C2H2 Zn finger 1516..1540 CDD:275368
C2H2 Zn finger 1568..1586 CDD:275368
HOX 2091..2146 CDD:197696
Homeobox 2190..2244 CDD:365835
COG5576 2527..2647 CDD:227863 23/93 (25%)
Homeobox 2557..2610 CDD:365835 16/52 (31%)
Homeobox 2880..2933 CDD:365835
C2H2 Zn finger 3348..3390 CDD:275371
C2H2 Zn finger 3392..3414 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.