DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and med9

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_004918128.1 Gene:med9 / 100485886 XenbaseID:XB-GENE-987612 Length:114 Species:Xenopus tropicalis


Alignment Length:91 Identity:16/91 - (17%)
Similarity:31/91 - (34%) Gaps:28/91 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 KEINEQARRDREEQE----------------------------KMKAQETMKSAQQNKQVQQQQQ 497
            :|..::|..:.||:|                            |.|.|...|.......:....:
 Frog    16 EEEEDEAAEEEEEEEYTFLPLVHDIIKCMDKDSQDVYQELNELKSKFQAMRKLVGNMPGIDLSPE 80

  Fly   498 QQQQQQQQQQQQHQQQQQQPQDHHSI 523
            :||:..|..::|.|.:.:..|.:.|:
 Frog    81 EQQRHLQSLREQVQTKNELLQKYKSL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475
Abdominal-A 456..478 CDD:289192 6/44 (14%)
med9XP_004918128.1 Med9 32..106 CDD:369417 10/73 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.