DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and kif2a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002934245.2 Gene:kif2a / 100379688 XenbaseID:XB-GENE-951755 Length:745 Species:Xenopus tropicalis


Alignment Length:117 Identity:25/117 - (21%)
Similarity:47/117 - (40%) Gaps:42/117 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 NRRMKLKKELRAVKEINEQARRDREEQEKMKAQ-------ETMKSAQQN---------------- 489
            |:.:|.::.:..||  ||...||........|:       |...|||||                
 Frog    88 NKIVKNRRTVAPVK--NETPARDNRVAAVSSARARPSQPIEQSASAQQNGSVSDISPDQPGKKDF 150

  Fly   490 -----------KQVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHSIIAHNPGH 530
                       |:|::.|:::::::.|||:..:::.|      .:.|.||.:
 Frog   151 GPPSRRKSNCVKEVEKLQEKREKRRLQQQELREKKAQ------DVDATNPNY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 2/5 (40%)
Abdominal-A 456..478 CDD:289192 6/21 (29%)
kif2aXP_002934245.2 KISc_KIF2_like 224..552 CDD:276818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.