DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and LOC100364002

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_006257545.2 Gene:LOC100364002 / 100364002 RGDID:2321855 Length:227 Species:Rattus norvegicus


Alignment Length:217 Identity:49/217 - (22%)
Similarity:68/217 - (31%) Gaps:55/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 DTVMNSYQSMSVPASASAQFAQFYQH-ATAAASAV------SAASAGAI---GVDSLGNACTQPA 348
            ||..:|.||.....|..|:.....|| .||..|..      |....|.:   |:|.     .|||
  Rat     2 DTPQDSCQSFQKSLSLGAEVDPEQQHGGTAVVSEAREVGDQSQRLVGGLVQGGLDQ-----GQPA 61

  Fly   349 SGVMPG----------------AGGAGGAGIADLPRYPWMTLTDWMGSPFERVV----------- 386
            .|.:.|                |.|.|..|.............|....|.:..|           
  Rat    62 QGQLAGGNLPQEEPAELSLAQDATGVGEEGDEKEEEMEARYAGDGAYGPEDNNVQQEGDQHPNDQ 126

  Fly   387 -------------CGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLT 438
                         .|...|.|....|..|..:|..|..:||:.|....|.:.|.|.:||..:.:.
  Rat   127 EQPQQEAAIPEGSRGQQAGNNLAHPRYSRTRFTPSQLRDLERLFQETRYPSLRTRKDIARWMGVE 191

  Fly   439 ERQIKIWFQNRRMKLKKELRAV 460
            |..::.||:.||...::..|.:
  Rat   192 ECDVQNWFRMRRSLFQRSRRVL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 16/51 (31%)
Abdominal-A 456..478 CDD:289192 1/5 (20%)
LOC100364002XP_006257545.2 Homeobox 154..211 CDD:395001 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.