DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002727852.1 Gene:Hoxb2 / 100361765 RGDID:2319509 Length:355 Species:Rattus norvegicus


Alignment Length:274 Identity:76/274 - (27%)
Similarity:100/274 - (36%) Gaps:113/274 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 QQLLLTPPSAGNSQAGDSSCSPSPSAS-GSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAA 247
            :..|:.||.....|.       .||.. |:|:|.|      |||...:....|.........|  
  Rat    39 ESTLIPPPPPPLEQT-------FPSLQLGASTLQR------PGSQKPAGDGPALRPPPPLPVA-- 88

  Fly   248 AAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQ 312
                     |.:..:|::.                  |.||..:.:       ||.:.|      
  Rat    89 ---------PPAPEFPWMK------------------EKKSAKKPS-------QSAATP------ 113

  Fly   313 FAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDW 377
                    :.|||:|.|:..|:            |:.|  ||...:||:|               
  Rat   114 --------SPAASSVRASGVGS------------PSDG--PGLPESGGSG--------------- 141

  Fly   378 MGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQI 442
                                .||.|..||..|.||||||||||.||.|.||:|||..|.|||||:
  Rat   142 --------------------SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQV 186

  Fly   443 KIWFQNRRMKLKKE 456
            |:||||||||.|::
  Rat   187 KVWFQNRRMKHKRQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 37/51 (73%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
Hoxb2XP_002727852.1 Homeobox 146..198 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.