DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and isl2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001159513.1 Gene:isl2 / 100306962 XenbaseID:XB-GENE-487556 Length:333 Species:Xenopus tropicalis


Alignment Length:136 Identity:36/136 - (26%)
Similarity:60/136 - (44%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 VVCG------DFNGPNGCPRRRGRQT--YTRFQTLELEKEFHF--NHYLTRRR-----RIEIAHA 434
            ::||      |...|:.......:||  .||.:|:..||:.|.  ..|....|     :.::...
 Frog   137 LLCGAEHNLSDSGRPSSLRSHIHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEM 201

  Fly   435 LCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQE-----KMKAQETMK--SAQQNKQV 492
            ..|:.|.|::||||:|.|.||:...:|::.:|...|:...:     .|.|...::  ||.|...|
 Frog   202 TGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQLNDKTSLQGLTGTPMVAGSPIRHDSAVQGSAV 266

  Fly   493 QQQQQQ 498
            :.|..|
 Frog   267 EVQTYQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 19/60 (32%)
Abdominal-A 456..478 CDD:289192 3/26 (12%)
isl2NP_001159513.1 LIM1_Isl 27..81 CDD:188752
LIM2_Isl 89..143 CDD:188760 2/5 (40%)
HOX 165..221 CDD:197696 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.