DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxd8

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001135589.1 Gene:hoxd8 / 100216142 XenbaseID:XB-GENE-920113 Length:231 Species:Xenopus tropicalis


Alignment Length:164 Identity:66/164 - (40%)
Similarity:89/164 - (54%) Gaps:46/164 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 CTQPASGVMPGAGGAGGAGIADLPR-------YPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRG 401
            |..|::.:        ||....|.:       :|||.         .:|..|         ||||
 Frog   104 CKSPSASI--------GADPEHLHQNSPASHMFPWMR---------AQVAPG---------RRRG 142

  Fly   402 RQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQ 466
            ||||:|||||||||||.||.||||:||||::|||.|||||:||||||||||.|||          
 Frog   143 RQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKE---------- 197

  Fly   467 ARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQ 500
               :.:::..:.:||..:.|.:...:.|:||.::
 Frog   198 ---NSKDKFPVSSQEGKEEADKKGGLHQEQQGRE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 43/51 (84%)
Abdominal-A 456..478 CDD:289192 1/21 (5%)
hoxd8NP_001135589.1 Homeobox 143..196 CDD:365835 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.