DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxc3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002936696.1 Gene:hoxc3 / 100190990 XenbaseID:XB-GENE-5997986 Length:394 Species:Xenopus tropicalis


Alignment Length:214 Identity:68/214 - (31%)
Similarity:90/214 - (42%) Gaps:47/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 FAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMS---VPASASAQFAQ 315
            |.:|     |..:|..:||.|...:.|.    |...|..::.........|   :|.|||.|   
 Frog    44 FCLP-----PDTANGSASHKGEHSIKGI----DFHLSEVSEQAQQPKSPNSDSPLPKSASTQ--- 96

  Fly   316 FYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPR--YPWMTLTDWM 378
                     |..|..|.|.:..|.           ..|.....|    :::|:  :|||..|...
 Frog    97 ---------SCTSKKSTGPVSSDV-----------TSPNKKSKG----SNMPKQIFPWMKETRQN 137

  Fly   379 GSPFERVVCGDFNGPN------GCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCL 437
            ....::......:.|.      ....:|.|..||..|.:|||||||||.||.|.||:|:|..|.|
 Frog   138 SKQKKQAPPPADDAPAVDSSFLSSASKRARTAYTNSQLVELEKEFHFNRYLCRPRRLEMAKLLNL 202

  Fly   438 TERQIKIWFQNRRMKLKKE 456
            :||||||||||||||.||:
 Frog   203 SERQIKIWFQNRRMKFKKD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 36/51 (71%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
hoxc3XP_002936696.1 Homeobox 167..220 CDD:395001 36/52 (69%)
DUF4074 335..392 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.