DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and lhx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001093698.1 Gene:lhx1 / 100101708 XenbaseID:XB-GENE-482482 Length:409 Species:Xenopus tropicalis


Alignment Length:157 Identity:39/157 - (24%)
Similarity:64/157 - (40%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 RRRGRQTYTRFQTLE-LEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLK--KELRA 459
            :|||.:|..:.:.|| |:..|......||..|.::|....|..|.|::||||||.|.:  |:|.|
 Frog   182 KRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSA 246

  Fly   460 V----KEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQ---QQQHQQQQQQP 517
            :    .......||.|...::::..|.:.:...:.....|.:.........   |.....|.|.|
 Frog   247 LGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGSNYDFFPQGPPSSQAQTP 311

  Fly   518 QDHHSIIAHNP-----GHLHHSVVGQN 539
            .|...:.:..|     |.:.|.:.|.:
 Frog   312 VDLPFVPSSGPAGTPLGAMDHPIPGHH 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 19/52 (37%)
Abdominal-A 456..478 CDD:289192 5/25 (20%)
lhx1NP_001093698.1 LIM1_Lhx1_Lhx5 4..55 CDD:188753
LIM2_Lhx1_Lhx5 63..118 CDD:188761
Homeobox 186..240 CDD:365835 19/53 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.