DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Rhox2c

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001092788.1 Gene:Rhox2c / 100039948 MGIID:3770266 Length:191 Species:Mus musculus


Alignment Length:196 Identity:48/196 - (24%)
Similarity:78/196 - (39%) Gaps:43/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 EDKSCSRYTDTVM--------NSYQS-MSVPASASAQFAQFYQHATAAASAVSAASA-------- 332
            ||:..:....|:|        |..:| ..:|.| .|..|:.|:....:|..::|..|        
Mouse    16 EDEENANGIKTLMVLLAGEGRNEGESGRGLPGS-GASAAEGYRAGELSAGGLAAPVADLMDNSNQ 79

  Fly   333 ---GAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRY--PWMTLTDWMGSPFERVVCGDFNG 392
               ||.|.|.  ....||...|....|     .:.::.|.  ||.|:     :|. ||:...|  
Mouse    80 EDLGATGCDQ--EKEKQPEEPVPDSMG-----DLENVKRVSGPWSTV-----NPV-RVLVPKF-- 129

  Fly   393 PNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKEL 457
                 |...:|::...|..|||..|..|||::.:....:|.::.::|..::.||..||.|.:...
Mouse   130 -----RHGWQQSFNVLQLQELESIFQCNHYISTKEANRLARSMGVSEATVQEWFLKRREKYRSYK 189

  Fly   458 R 458
            |
Mouse   190 R 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 16/51 (31%)
Abdominal-A 456..478 CDD:289192 1/3 (33%)
Rhox2cNP_001092788.1 homeodomain 134..186 CDD:238039 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.