Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001092788.1 | Gene: | Rhox2c / 100039948 | MGIID: | 3770266 | Length: | 191 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 48/196 - (24%) |
---|---|---|---|
Similarity: | 78/196 - (39%) | Gaps: | 43/196 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 285 EDKSCSRYTDTVM--------NSYQS-MSVPASASAQFAQFYQHATAAASAVSAASA-------- 332
Fly 333 ---GAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRY--PWMTLTDWMGSPFERVVCGDFNG 392
Fly 393 PNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKEL 457
Fly 458 R 458 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 16/51 (31%) |
Abdominal-A | 456..478 | CDD:289192 | 1/3 (33%) | ||
Rhox2c | NP_001092788.1 | homeodomain | 134..186 | CDD:238039 | 16/51 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |