DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and nkx6-2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002937836.1 Gene:nkx6-2 / 100038084 XenbaseID:XB-GENE-484527 Length:281 Species:Xenopus tropicalis


Alignment Length:280 Identity:68/280 - (24%)
Similarity:104/280 - (37%) Gaps:57/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 AAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHG-GLSGMAGFTGLEDKSCSRYTDTVMNSYQSM 303
            |...::...||..:.|...:.::||...:||... |||.:                       |.
 Frog    14 AFVLSSTPLAALHNMAEMKTTLFPYALQNPSFKAPGLSSL-----------------------SA 55

  Fly   304 SVPASASAQFAQFYQH---ATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIAD 365
            .:|.......:.....   ||..:||...:|     :..:....|.......|.|.......:|:
 Frog    56 QIPLGTPHGISDILSRPLGATLGSSANLLSS-----LPRINGLATSTGMYFNPAAVSRYPKPLAE 115

  Fly   366 LP-RYPWMTLTDWMGSPFERVVCGDFNGPN-GCPRRRG------------RQTYTRFQTLELEKE 416
            || |.|........|||        :..|. |||.:.|            |.|::..|...|||.
 Frog   116 LPGRAPIFWPGVMQGSP--------WRDPRLGCPSQAGMVLDKDGKKKHSRPTFSGQQIFALEKT 172

  Fly   417 FHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMK-AQ 480
            |....||....|..:|::|.:||.|:|:||||||.|.:|  |...|:....::...|.|||| :.
 Frog   173 FEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK--RHAAEMATAKKKHDSETEKMKESS 235

  Fly   481 ETMKSAQQNKQVQQQQQQQQ 500
            |..:..:.||.:......::
 Frog   236 ENEEDDEYNKPLDPNSDDEK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 5/21 (24%)
nkx6-2XP_002937836.1 Homeobox 157..211 CDD:365835 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.