Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001164669.1 | Gene: | not / 100038059 | XenbaseID: | XB-GENE-478518 | Length: | 236 | Species: | Xenopus tropicalis |
Alignment Length: | 218 | Identity: | 54/218 - (24%) |
---|---|---|---|
Similarity: | 77/218 - (35%) | Gaps: | 60/218 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 310 SAQFAQFYQH-----ATAAASAVSAASAGAIGVDSLGNACTQPASGVM-----------PGAGGA 358
Fly 359 GGAGIADLP---------RYPWMTLTDWMGSPFERVVCGD----------FNGPNG--------- 395
Fly 396 --CPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELR 458
Fly 459 AVKEINEQARRDREEQEKMKAQE 481 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 24/51 (47%) |
Abdominal-A | 456..478 | CDD:289192 | 3/21 (14%) | ||
not | NP_001164669.1 | Homeobox | 142..194 | CDD:278475 | 24/51 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |