DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and not

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001164669.1 Gene:not / 100038059 XenbaseID:XB-GENE-478518 Length:236 Species:Xenopus tropicalis


Alignment Length:218 Identity:54/218 - (24%)
Similarity:77/218 - (35%) Gaps:60/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 SAQFAQFYQH-----ATAAASAVSAASAGAIGVDSLGNACTQPASGVM-----------PGAGGA 358
            |..|..|..|     |.:.:|.:......:..:||:.:...:|...|.           |.....
 Frog     4 SPVFPAFGHHLAEHPAMSISSELPRTPKASFNIDSILSRADRPVPKVSMEMPSWQPPSPPSVPYR 68

  Fly   359 GGAGIADLP---------RYPWMTLTDWMGSPFERVVCGD----------FNGPNG--------- 395
            ...|:...|         .||.|.....|..|.....|.|          .:.|||         
 Frog    69 YSYGMMPYPPVWLIKPTVGYPSMAQQQPMRMPRGECPCPDPACKERGLLYSHCPNGSMNPLSWRT 133

  Fly   396 --CPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELR 458
              |..:|.|..:|..|...|||||....|:....|:::|..|.|||.|:|:||||||:|.:|:  
 Frog   134 GPCKMKRIRTVFTPEQLERLEKEFLKQQYMVGTERVDLASTLNLTETQVKVWFQNRRIKWRKQ-- 196

  Fly   459 AVKEINEQARRDREEQEKMKAQE 481
                        ..||:|.|..:
 Frog   197 ------------SLEQKKAKLSQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 24/51 (47%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
notNP_001164669.1 Homeobox 142..194 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.