DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and cdx1b

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001092232.1 Gene:cdx1b / 100004956 ZFINID:ZDB-GENE-070615-29 Length:255 Species:Danio rerio


Alignment Length:218 Identity:65/218 - (29%)
Similarity:87/218 - (39%) Gaps:66/218 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 LEDKSCSRYTDTV----MNSYQSMSVPASASAQFAQF--YQHAT--------------------- 321
            |.||..|.|.::|    :|......||  |..|:..|  |.|..                     
Zfish     6 LLDKDSSMYPNSVRHPSLNLNPQNFVP--APPQYPDFTGYHHVPGITTNDPHHSQTGSWNPAYPP 68

  Fly   322 --------AAASAVSAASAGAIGVDS-----------LGNACTQPASGVMPGAGGAGGAGIADLP 367
                    ...|.||::|.|.:|...           |.::.......:.|.|          ..
Zfish    69 PREEWTPYGPGSGVSSSSTGQLGFSPPEFSSVQTPGLLQSSINSSVGQLSPNA----------QR 123

  Fly   368 RYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIA 432
            |.|:    |||    .|.|....:|.....:.:.|..||..|.||||||||::.|:|.||:.|:|
Zfish   124 RNPY----DWM----RRSVPPASSGGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELA 180

  Fly   433 HALCLTERQIKIWFQNRRMKLKK 455
            .||.|:|||:||||||||.|.:|
Zfish   181 TALSLSERQVKIWFQNRRAKERK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 33/51 (65%)
Abdominal-A 456..478 CDD:289192 65/218 (30%)
cdx1bNP_001092232.1 Caudal_act 13..132 CDD:282574 24/138 (17%)
Homeobox 150..202 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.