DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut3 and ARN2

DIOPT Version :9

Sequence 1:NP_536732.1 Gene:Glut3 / 42036 FlyBaseID:FBgn0015230 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_011816.2 Gene:ARN2 / 856338 SGDID:S000001039 Length:620 Species:Saccharomyces cerevisiae


Alignment Length:281 Identity:59/281 - (20%)
Similarity:92/281 - (32%) Gaps:94/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 DPTESEREVRQGPLLGFKYKKVRRS--LARSLAIALLQK--LCGALIFIF-YGLN-------MLD 318
            |...|.|:..:..|.|.|...:|:|  :|:......|:.  |..|.|..| |||:       |..
Yeast    32 DDDSSPRDEMKDKLKGTKSLIIRKSELMAKKYDTWQLKAIFLFSAFICTFAYGLDSSIRGTYMTY 96

  Fly   319 CLRIRREFGLILCLGLILGFLACFF------LVDRLGRRPLLIFS-------------------- 357
            .:.......||..:.:|:..::...      |.|..||..|.:.|                    
Yeast    97 AMNSYSAHSLISTVSVIVLMISAVSQVIFGGLSDIFGRLTLFLVSIVLYIVGTIIQSQAYDVQRY 161

  Fly   358 SAGIVFVSIYL-GLHFKV-----------WMTMGLTVMSWIALFCIAIFVGCYTAGVGSLTWVLN 410
            :||.||..:.| |:..:|           |......:.||.::.               .|||..
Yeast   162 AAGAVFYYVGLVGVMLQVVLMLSDNSSLKWRLFYTLIPSWPSII---------------TTWVSG 211

  Fly   411 AELLVRPMRPLGCSIVCAFNW-----LTAF-FVICWFGSHGVKCQPYLFLLFAIIASLILLFSLI 469
            :  :|....||.       ||     :.|| |.:|        |.|      .|:..|.:.:.:.
Yeast   212 S--VVEAANPLE-------NWSWNIAMWAFIFPLC--------CIP------LILCMLHMRWKVR 253

  Fly   470 YIPETKKLSSAKIQQRLGGLI 490
            ...|.|:|...|...:..||:
Yeast   254 NDVEWKELQDEKSYYQTHGLV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut3NP_536732.1 Sugar_tr 60..484 CDD:278511 57/273 (21%)
MFS 63..>226 CDD:119392
ARN2NP_011816.2 MFS_ARN_like 69..581 CDD:340880 49/244 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.