DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut3 and ATR2

DIOPT Version :9

Sequence 1:NP_536732.1 Gene:Glut3 / 42036 FlyBaseID:FBgn0015230 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_014006.1 Gene:ATR2 / 855322 SGDID:S000004892 Length:540 Species:Saccharomyces cerevisiae


Alignment Length:415 Identity:77/415 - (18%)
Similarity:125/415 - (30%) Gaps:204/415 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LLPNFLGWFLTVFARSVPMLYAGRF-------FLGMCGGAHCVVVPIYNAEISTTKKRGAMGVVF 186
            :|||.:|....|:.       .|.|       |:|.|                 ....|..|.:|
Yeast   179 ILPNIMGLVGHVYK-------VGSFRKNIVISFIGAC-----------------APTGGMFGGLF 219

  Fly   187 EGACIC-------GVIYSFAMSLFLELRIINFVNLGLLALGPLQILMPESPAYYVDHGNIPRAED 244
            .|..:.       .|.|:|.::.||.|                  ||    |:|....|:|    
Yeast   220 GGLIVTEDPNQWPWVFYAFGIATFLSL------------------LM----AWYSIPNNVP---- 258

  Fly   245 SLRFLRGQKYDTRREIDFLTRDPTESEREV----------RQGPLLGF----------------- 282
                         ..|..|:.|.|.|...:          .|.|::|:                 
Yeast   259 -------------TNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLV 310

  Fly   283 -------KYKKV---RRSLA--RSLAIALLQKLCG-------ALIFIFYGLNMLDCLRIRREFGL 328
                   ||.:|   .|::.  |.:.:.||....|       ...::.:.||:       |.:..
Yeast   311 AFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNL-------RHYSP 368

  Fly   329 ILCLG-----LILGFLACFFL---VDRLGRRPLLIFS----SAGIVFVSI------YLGLHF--- 372
            :...|     :|.|.:|.||:   :.|||...||.||    .||.:..|:      |..|:|   
Yeast   369 VWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQ 433

  Fly   373 --------------KVWMTMGL-------------TVMSWIALFCI------------------- 391
                          .:.::.||             ||:::.|..|:                   
Yeast   434 AILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLK 498

  Fly   392 ----AIFVGCYTAGVG---SLTWVL 409
                |:::|...|.:|   |:|::|
Yeast   499 GYRAAVYLGVGLASLGVVISVTYML 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut3NP_536732.1 Sugar_tr 60..484 CDD:278511 77/415 (19%)
MFS 63..>226 CDD:119392 20/110 (18%)
ATR2NP_014006.1 MFS_Amf1_MDR_like 74..519 CDD:341029 74/409 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.