DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut3 and ATR1

DIOPT Version :9

Sequence 1:NP_536732.1 Gene:Glut3 / 42036 FlyBaseID:FBgn0015230 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_013591.1 Gene:ATR1 / 854924 SGDID:S000004584 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:43/203 - (21%)
Similarity:70/203 - (34%) Gaps:73/203 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 ARSLAIALLQKLCGALIFI------FYGLNMLDCLRIRREFGLILCLGLILGFLA-----CFFLV 345
            ::|..:|....:.|:.|.|      .|||..:    :...:.|::...||.|...     .||::
Yeast   106 SKSWLMASFPLVSGSFILISGRLGDIYGLKKM----LLVGYVLVIIWSLICGITKYSGSDTFFII 166

  Fly   346 DRLGRRPLLIFSSAGIVFV---------SIYLGLHFKVWMTMGLTVMSWIALFCIAIFVGCYTAG 401
            .|       .|...||.||         :||:|..|:..:.:.              |||.    
Yeast   167 SR-------AFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVIS--------------FVGA---- 206

  Fly   402 VGSLTWVLNAELLVRPMRPLGCSIVCAFNWLTAFFVICWFGSHGVKCQPYLFLLFAIIASLILLF 466
                            |.|:|.::.|.|..|        .|:...|..|:.|..::|.|.:..:.
Yeast   207 ----------------MAPIGATLGCLFAGL--------IGTEDPKQWPWAFYAYSIAAFINFVL 247

  Fly   467 SLIYIPET 474
            |:..||.|
Yeast   248 SIYAIPST 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut3NP_536732.1 Sugar_tr 60..484 CDD:278511 43/203 (21%)
MFS 63..>226 CDD:119392
ATR1NP_013591.1 MFS_Amf1_MDR_like 73..517 CDD:341029 43/203 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.