DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut3 and TMT2

DIOPT Version :9

Sequence 1:NP_536732.1 Gene:Glut3 / 42036 FlyBaseID:FBgn0015230 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001190923.1 Gene:TMT2 / 829684 AraportID:AT4G35300 Length:739 Species:Arabidopsis thaliana


Alignment Length:213 Identity:53/213 - (24%)
Similarity:96/213 - (45%) Gaps:29/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GWSGT----AERSVMEQHSYSFQPTELQWSGVCILLTL-GAALWCLPMGLMVRLLGCRRTILIQL 129
            ||...    |...:.::.:....|:.   .|:.:.::| ||.|.....|.:...||.|..:::..
plant    19 GWDNATIAGAVLYIKKEFNLESNPSV---EGLIVAMSLIGATLITTCSGGVADWLGRRPMLILSS 80

  Fly   130 LPNFLGWFLTVFARSVPMLYAGRFFLGMCGGAHCVVVPIYNAEISTTKKRGAMGVV--FEGACIC 192
            :..|:|..:.:::.:|.:|..||...|...|....:||||.:|.:..:.||.:..:  |.|:  .
plant    81 ILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIYISETAPPEIRGLLNTLPQFTGS--G 143

  Fly   193 GVIYSFAMSLFLEL------RIINFVNLGLLALGPL------QILMPESPAYYVDHGNIPRAEDS 245
            |:..|:.|...:.|      |::    ||:|.:..|      ...:||||.:.|..|.:..|:..
plant   144 GMFLSYCMVFGMSLMPSPSWRLM----LGVLFIPSLVFFFLTVFFLPESPRWLVSKGRMLEAKRV 204

  Fly   246 LRFLRGQKYDTRREIDFL 263
            |:.|||:: |...|:..|
plant   205 LQRLRGRE-DVSGEMALL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut3NP_536732.1 Sugar_tr 60..484 CDD:278511 53/213 (25%)
MFS 63..>226 CDD:119392 39/174 (22%)
TMT2NP_001190923.1 MFS 14..>174 CDD:421695 38/163 (23%)
MFS <516..713 CDD:421695
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48021
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.