DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut3 and TMT3

DIOPT Version :9

Sequence 1:NP_536732.1 Gene:Glut3 / 42036 FlyBaseID:FBgn0015230 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001190054.1 Gene:TMT3 / 824312 AraportID:AT3G51490 Length:737 Species:Arabidopsis thaliana


Alignment Length:262 Identity:62/262 - (23%)
Similarity:116/262 - (44%) Gaps:51/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 REVRQGPLLGFKYKK---VRRSLARSLAIALLQKLCGALIFIFY--------GL-NMLDCLRIRR 324
            :||:.||  |::..|   |:|:|...:.:.:||:..|....::|        |: ::|..|.|..
plant   492 KEVKDGP--GWRELKEPGVKRALMVGVGLQILQQFAGINGVMYYTPQILEETGVSSLLTNLGISA 554

  Fly   325 EFGLILCLGL-ILGFLACFF----LVDRLGRR-------PLLIFSSAGIVFVSIYLGLHFKVWMT 377
            |...:|...| .|..|.|..    |:|..|||       |:||.|...:|..|:         :.
plant   555 ESASLLISALTTLLMLPCILVSMRLMDVTGRRSLMLSTIPILILSLVTLVIGSL---------VN 610

  Fly   378 MGLTVMSWIALFCIAIFVGCYTAGVGSLTWVLNAELLVRPMRPLGCSIVCAFNWLTAFFVICW-- 440
            :|.::.:.|:...:.:::.|:..|.|::..:|.:|:....:|.| |..:||..:.....::.:  
plant   611 LGGSINALISTASVTVYLSCFVMGFGAIPNILCSEIFPTSVRGL-CITICALTFWICDIIVTYTL 674

  Fly   441 ------FGSHGVKCQPYLFLLFAIIASLILLFSLIYIPETKKLSSAKIQQRLG-GLINRPAVITF 498
                  .|..||      |.::||:.::..:|..:.:||||.:....|.:... |...:.|..:|
plant   675 PVMLKSIGIAGV------FGIYAIVCAVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAAASF 733

  Fly   499 TS 500
            .|
plant   734 LS 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut3NP_536732.1 Sugar_tr 60..484 CDD:278511 58/243 (24%)
MFS 63..>226 CDD:119392
TMT3NP_001190054.1 MFS 9..>186 CDD:119392
MFS <512..703 CDD:119392 45/206 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48021
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.