DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut3 and CG31100

DIOPT Version :9

Sequence 1:NP_536732.1 Gene:Glut3 / 42036 FlyBaseID:FBgn0015230 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001262395.1 Gene:CG31100 / 41075 FlyBaseID:FBgn0051100 Length:716 Species:Drosophila melanogaster


Alignment Length:379 Identity:93/379 - (24%)
Similarity:142/379 - (37%) Gaps:89/379 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 YKATLYSNIGSFFFGIAVGW-----------SGTAERSVMEQHSYSFQPTELQWSG----VCILL 101
            :.|....||..|.:|:.:|:           .|.:|.|    ........|:.|..    :|:  
  Fly    51 FLAVSIKNILLFGYGMTLGFPTIVIPAIQGGEGRSETS----GDILLNKDEISWFSSINLICV-- 109

  Fly   102 TLGAALWCLPMGLMVRLLGCRRTILIQLLPNFLGWFLTVFARSVPMLYAGRFFLGMCGGAHCVVV 166
                .|.||..||:.:.||.||.:....||....|.:..||.....|||.....|:.||.....|
  Fly   110 ----PLGCLFSGLLTQPLGKRRAMQFVNLPILAAWLMFHFATRTEHLYAALCLAGLGGGLMEAPV 170

  Fly   167 PIYNAEISTTKKRGAMGVVFEGACICGVIYSFAMSLFLELRIINFVNLGLLALGPLQILM----P 227
            ..|.|||:..|.||.:..:.....|.||...|.:...::.|.:..|:   .|...:.|:|    |
  Fly   171 LTYVAEITEPKYRGILSALGTTCVITGVFIQFILGSLMDWRSVAAVS---SAFPVITIIMLCFVP 232

  Fly   228 ESPAYYVDHGNIPRAEDSLRFLRG------------QKYD---TRREIDFLTRD--PTESEREVR 275
            |||.:.:.......|..||::|||            |.||   |::.|: |:.|  |...:|.. 
  Fly   233 ESPVWLIREQRFREAVKSLQWLRGWVPEHMIEAEFNQLYDELITQKAIE-LSADGIPPPGQRRT- 295

  Fly   276 QGPLLGFKYKKVRRSLARSLAIALLQKLCGALIFIF-------------YGLNMLDCLRIRRE-- 325
                ||.:.:..|:   ||..:..|     .:.|.|             |.:.:...|:....  
  Fly   296 ----LGQRLRMWRK---RSFLVPFL-----LVSFSFFTGHFSGKTPLQTYAVQIFHTLKAPMNKY 348

  Fly   326 -----FGLILCLGLILGFLACFFLVDRLGRRPLLIFSS--AGIVFVSIYLGLHF 372
                 .|:...|..|||.:    |:...|:|||::.|:  .|:.|.......||
  Fly   349 HATILLGVAEMLATILGVV----LIHFTGKRPLVLVSTVGTGLCFFGTATYAHF 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut3NP_536732.1 Sugar_tr 60..484 CDD:278511 91/371 (25%)
MFS 63..>226 CDD:119392 45/177 (25%)
CG31100NP_001262395.1 MFS 59..>232 CDD:119392 47/185 (25%)
Sugar_tr 98..633 CDD:278511 83/328 (25%)
MFS <531..616 CDD:119392
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48021
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.