DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glut3 and srx-118

DIOPT Version :9

Sequence 1:NP_536732.1 Gene:Glut3 / 42036 FlyBaseID:FBgn0015230 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_496675.2 Gene:srx-118 / 188681 WormBaseID:WBGene00006009 Length:328 Species:Caenorhabditis elegans


Alignment Length:222 Identity:49/222 - (22%)
Similarity:91/222 - (40%) Gaps:55/222 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 LAIALLQKLCGALIFI--FYGLNMLD------CLRIRREFG-LILCLGLILGFLACFFLVDRLGR 350
            :.::::..:...||||  |:.:...|      |.   ..|| .|:|    :|:||  |.|     
 Worm    27 IVVSIIGSIMNVLIFIATFFRVTKRDGFLKICCF---NSFGSCIVC----IGYLA--FPV----- 77

  Fly   351 RPLLIFSSAGIVFVSIYLGLHFKVWM--TMG------LTVMSWIALFCIAIFVGCY-----TAGV 402
             |.|:.......:::..:| .|..|.  ::|      |||...||::...:::..|     ..|:
 Worm    78 -PSLLLEDPPNHWLNAAMG-QFIAWFGWSIGPLSQILLTVNRIIAVYFPLLYMKKYRYNPTNVGI 140

  Fly   403 GSLTWVLNAELLVRPMRPLGCSIVCAFNWLTAFFVICWFGSH----GVKCQPYLFLLFAIIA--- 460
            |...:|  |.:|:....|.||..:...::|.      |.|..    .:..:.:|.::..|.|   
 Worm   141 GFSFFV--AFILLVSFFPEGCHYLFNRDYLG------WVGEFTPCIDIMQKTFLVVMMTICALTT 197

  Fly   461 --SLILLFSLIYIPETKKLSSAKIQQR 485
              |::|...||......::|:|::..|
 Worm   198 CCSVLLFIKLIIHSPNFRVSNAQLANR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glut3NP_536732.1 Sugar_tr 60..484 CDD:278511 48/219 (22%)
MFS 63..>226 CDD:119392
srx-118NP_496675.2 7TM_GPCR_Srx 27..285 CDD:370981 49/222 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.