powered by:
Protein Alignment Glut3 and K09C4.2
DIOPT Version :9
Sequence 1: | NP_536732.1 |
Gene: | Glut3 / 42036 |
FlyBaseID: | FBgn0015230 |
Length: | 507 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001361999.1 |
Gene: | K09C4.2 / 187193 |
WormBaseID: | WBGene00019548 |
Length: | 152 |
Species: | Caenorhabditis elegans |
Alignment Length: | 55 |
Identity: | 12/55 - (21%) |
Similarity: | 24/55 - (43%) |
Gaps: | 12/55 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 421 LGCSIVCAFNWLTAFFVICWFGSHGVKCQPYLFLLFAIIASLILLFSLIYIPETK 475
:|..:|..|..:.:.| .|..|:.|.|:.::..::...|:|||:
Worm 45 VGMPVVSLFPIINSIF------------SPIFFVPFVIVQTVFGIYLYRYMPETR 87
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Glut3 | NP_536732.1 |
Sugar_tr |
60..484 |
CDD:278511 |
12/55 (22%) |
MFS |
63..>226 |
CDD:119392 |
|
K09C4.2 | NP_001361999.1 |
MFS |
<11..89 |
CDD:391944 |
12/55 (22%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160157960 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.