DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and LBX2

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens


Alignment Length:85 Identity:34/85 - (40%)
Similarity:45/85 - (52%) Gaps:6/85 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 SESLAGSLLPDWLGTNGL---RRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQ 338
            ||..||   ||.||....   ||:.|..:|..|.||||:.|....||....|..:|..|.|...|
Human    67 SEGRAG---PDALGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQ 128

  Fly   339 IKIWFQNRRMKLKKEIQAIK 358
            :..||||||.|||::::.::
Human   129 VVTWFQNRRAKLKRDVEEMR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 24/55 (44%)
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 10/24 (42%)
Homeodomain 86..142 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.