DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and HB16

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 / 830169 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana


Alignment Length:116 Identity:34/116 - (29%)
Similarity:54/116 - (46%) Gaps:18/116 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 KIRSDLTQYGGISTD--------MGKRYSESLAG-----SLLPDWLGTN---GLRRRGRQTYTRY 305
            ::.|..:..|.|||.        .|..|...|.|     :|:.::.|.:   ||..:.|:.... 
plant     3 RLSSSDSMCGLISTSTDEQSPRGYGSNYQSMLEGYDEDATLIEEYSGNHHHMGLSEKKRRLKVD- 66

  Fly   306 QTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLK-KEIQ 355
            |...|||.|...:.|...|:.::|..|.|..||:.:||||||.:.| |:::
plant    67 QVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLE 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 20/56 (36%)
HB16NP_195716.1 Homeodomain 59..112 CDD:459649 19/53 (36%)
HALZ 114..155 CDD:460477 1/4 (25%)

Return to query results.
Submit another query.