DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and HB6

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:109 Identity:32/109 - (29%)
Similarity:50/109 - (45%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 PTKSKIRSDLTQYGGISTDMGKRYSESLAG-----SLLPDWLGTNGLRRRGRQTYTRYQTLELEK 312
            ||.|.......:||      |:.:...|.|     ..:.:..|..||..:.|:.... |...|||
plant    19 PTTSTDEQSPRRYG------GREFQSMLEGYEEEEEAIVEERGHVGLSEKKRRLSIN-QVKALEK 76

  Fly   313 EFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLK-KEIQ 355
            .|...:.|...|::::|..|.|..||:.:||||||.:.| |:::
plant    77 NFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 20/56 (36%)
HB6NP_565536.1 Homeodomain 62..115 CDD:459649 19/53 (36%)
HALZ 117..158 CDD:460477 1/4 (25%)

Return to query results.
Submit another query.