DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and gsx1

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001039254.1 Gene:gsx1 / 734120 XenbaseID:XB-GENE-855502 Length:243 Species:Xenopus tropicalis


Alignment Length:221 Identity:66/221 - (29%)
Similarity:89/221 - (40%) Gaps:73/221 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 NPAGGMPVRPSACTPDSRVGGYL-------------DTSGGSPVSHRGGSAGGNVSVSGGNGNAG 197
            :|..|:|.  .:|  .||..|.|             ....|.|:.....|:.|......|.|...
 Frog    35 HPLHGLPA--GSC--HSRKSGLLCVCPMCVTASHLHPPPPGIPLLKASFSSFGTQYCPAGLGRQH 95

  Fly   198 GVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDL 262
            ...:|:.|:            .|.|        |:||:    ||.        .||         
 Frog    96 SASTGINVS------------HGPA--------LYQAA----YPL--------PDP--------- 119

  Fly   263 TQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIE 327
            .|:..||.|..            |..|.::   :|.|..:|..|.||||:||.:|.||:|.||||
 Frog   120 RQFHCISVDSS------------PSQLSSS---KRMRTAFTSTQLLELEREFASNMYLSRLRRIE 169

  Fly   328 MAHALCLTERQIKIWFQNRRMKLKKE 353
            :|..|.|:|:|:||||||||:|.|||
 Frog   170 IATYLNLSEKQVKIWFQNRRVKHKKE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 31/52 (60%)
gsx1NP_001039254.1 homeobox 137..196 35/62 (56%)
Homeobox 141..194 CDD:365835 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.