DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxd9

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001166940.1 Gene:Hoxd9 / 688999 RGDID:1582908 Length:343 Species:Rattus norvegicus


Alignment Length:270 Identity:95/270 - (35%)
Similarity:119/270 - (44%) Gaps:73/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GSNGGGGGGGGGGGGGAGGTGGAG--NANGGNAANANGQN---NPAGGMPVRPSACTPDSRVGGY 167
            |..||.|||||.||||.||:||.|  .:.||   .|||::   .|..|....|||.:..|     
  Rat   112 GFPGGAGGGGGSGGGGGGGSGGPGPVPSPGG---PANGRHYGIKPETGAAPAPSAASTSS----- 168

  Fly   168 LDTSGGSPVSHRGGSAGGNVSVSGG--------------------NGNAGGVQSGVGVAGAGTAW 212
             .||..|.......||......|||                    .||..||  |:| .|.||  
  Rat   169 -STSSSSSSKRTECSAARESQGSGGPEFPCNSFLRDKAAAAAAAAAGNGPGV--GIG-TGPGT-- 227

  Fly   213 NANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYS 277
                   |.:::.:|.|. |.:      |...:..|..:.|...:.:.|                
  Rat   228 -------GGSSEPSACSD-HPS------PGCPLKEEEKQPPQPPQQQLD---------------- 262

  Fly   278 ESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIW 342
               ..:...:|:.....|:: |..||:||||||||||..|.||||.||.|:|..|.|||||:|||
  Rat   263 ---PNNPAANWIHARSTRKK-RCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIW 323

  Fly   343 FQNRRMKLKK 352
            |||||||:||
  Rat   324 FQNRRMKMKK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 38/52 (73%)
Hoxd9NP_001166940.1 Hox9_act 1..>155 CDD:282473 23/45 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..196 35/91 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..267 13/82 (16%)
HOX 276..328 CDD:197696 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.