DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and Hoxa6

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001178016.1 Gene:Hoxa6 / 685732 RGDID:1590236 Length:233 Species:Rattus norvegicus


Alignment Length:342 Identity:100/342 - (29%)
Similarity:120/342 - (35%) Gaps:155/342 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AYRGFPLSLGMSPYANHHLQRTTQDSP--YDASITA-ACNKI-YGDGAGAYKQDCLNIKADAVNG 99
            |.|.||.|.|.|     .|...|..||  |..|.:. |||:. |..||..:..|           
  Rat    34 ALRPFPASYGAS-----SLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSD----------- 82

  Fly   100 YKDIWNTGGSNGGGGGGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRP-SACTPDSR 163
             ||:                     .|...:||:.         |..|...:...| ....|||.
  Rat    83 -KDL---------------------SGASPSGNSK---------QRGPGDYLHFSPEQQYKPDSS 116

  Fly   164 VGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAA 228
                                    ||.|                                     
  Rat   117 ------------------------SVQG------------------------------------- 120

  Fly   229 SSLHQAS-----NHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDW 288
            .:||:..     ....||||.....|                               ||::    
  Rat   121 KALHEEGTDRKYTSPVYPWMQRMNSC-------------------------------AGAV---- 150

  Fly   289 LGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353
            .|::|  ||||||||||||||||||||.|.|||||||||:|:|||||||||||||||||||.|||
  Rat   151 YGSHG--RRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE 213

  Fly   354 IQAIKELNEQEKQAQAQ 370
            .:.|.......:.::|:
  Rat   214 NKLINSTQASGEDSEAK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 47/52 (90%)
Hoxa6NP_001178016.1 Homeobox 159..212 CDD:395001 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4717
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.