DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and lbx2

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:233 Identity:55/233 - (23%)
Similarity:91/233 - (39%) Gaps:51/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 SACTPDSRVGGYLDTSG----GSPVSHRGGSAGGNVSVSGGN----GNAGGVQSGVG-------- 204
            ::.:.|.:.|..|.:||    ..|:......|..|..::..:    .|...|:..||        
Zfish     2 TSSSKDMKAGSVLQSSGEERRRGPLDQLPPPANSNKPLTPFSIEDILNKPSVKKSVGSLCPPRVL 66

  Fly   205 --VAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGG 267
              |.|:..:.|      |.:|.::...:|.:.::.||........:..|.      |..:..:| 
Zfish    67 EKVTGSSASRN------GISAPSSPLCALEELASKTFKGLEVSVIQAAEG------REHINAFG- 118

  Fly   268 ISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHAL 332
             .....|:                   ||:.|..:|.:|..||||.|....||:...|.::|..|
Zfish   119 -QRQASKK-------------------RRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQL 163

  Fly   333 CLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQ 370
            .||..|:..||||||.|||::::.:|...|..|:...|
Zfish   164 GLTNAQVITWFQNRRAKLKRDLEEMKADVESLKKIPPQ 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 25/55 (45%)
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46 8/43 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 8/40 (20%)
Homeodomain 127..183 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.