DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxb10a

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_571616.1 Gene:hoxb10a / 58056 ZFINID:ZDB-GENE-000328-2 Length:279 Species:Danio rerio


Alignment Length:118 Identity:47/118 - (39%)
Similarity:72/118 - (61%) Gaps:4/118 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 SNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGR 299
            :|.:....::|:....:|...:.:::|.|:  |..|...|....:|..: ...||.....|:: |
Zfish   150 TNRSIITTLSISQRSKDDIEPNNLQTDFTR--GDKTPREKTQDVTLENA-ANGWLSAKAGRKK-R 210

  Fly   300 QTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 352
            ..|:::|.|||||||..|.||||.||:|::.::.||:||:|||||||||||||
Zfish   211 CPYSKHQILELEKEFLFNMYLTRERRLEISRSINLTDRQVKIWFQNRRMKLKK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 33/55 (60%)
hoxb10aNP_571616.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..112
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..187 5/21 (24%)
Homeodomain 207..263 CDD:459649 34/56 (61%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.