DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxa5a

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_571615.1 Gene:hoxa5a / 58055 ZFINID:ZDB-GENE-000823-9 Length:227 Species:Danio rerio


Alignment Length:221 Identity:85/221 - (38%)
Similarity:104/221 - (47%) Gaps:63/221 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PVRPSACTPDSRVGGYLDTS--GGSPVSHRGGSAGGNVSVSGGNGNA----GGVQSGVGVAGAGT 210
            ||..|:..|.|   .:|..|  ..||||.:...| ..:|:|...|:|    |.|.|..||:    
Zfish    49 PVTASSAEPSS---DHLPCSSLANSPVSEQSHRA-LKISLSSTAGSASKSFGTVLSREGVS---- 105

  Fly   211 AWNANCTISGAAAQTAAASSLHQASNHT-----FYPWMAIAGECPEDPTKSKIRSDLTQYGGIST 270
                  .:|.:..:.....|...||.:.     .||||          .|..|..|         
Zfish   106 ------KVSSSMEEEKPPGSGQTASQNVSEAPQIYPWM----------RKLHISHD--------- 145

  Fly   271 DMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLT 335
                    :|||   |:       .:|.|..||||||||||||||.|.|||||||||:||.|||:
Zfish   146 --------NLAG---PE-------GKRPRTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHTLCLS 192

  Fly   336 ERQIKIWFQNRRMKLKKEIQAIKELN 361
            ||||||||||||||.||: ..:|.:|
Zfish   193 ERQIKIWFQNRRMKWKKD-NKLKSMN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 44/52 (85%)
hoxa5aNP_571615.1 Homeobox 155..208 CDD:278475 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.