DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxa4a

DIOPT Version :9

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_571610.1 Gene:hoxa4a / 58050 ZFINID:ZDB-GENE-000823-4 Length:245 Species:Danio rerio


Alignment Length:166 Identity:61/166 - (36%)
Similarity:79/166 - (47%) Gaps:45/166 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 SVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPED 252
            |||..:|.....:|.||..|     |.:|::     .:.|.....::.....||||         
Zfish    85 SVSQNHGPRLTTESCVGSDG-----NKDCSL-----VSDALPGSQKSKEPVVYPWM--------- 130

  Fly   253 PTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTN 317
             .|..:.:....|.|                         |:.:|.|..|||.|.||||||||.|
Zfish   131 -KKVHVNTVTASYSG-------------------------GVPKRSRTAYTRQQALELEKEFHFN 169

  Fly   318 HYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353
            .|||||||:|:||.:||:|||:||||||||||.||:
Zfish   170 RYLTRRRRVEIAHTMCLSERQVKIWFQNRRMKWKKD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeobox 299..352 CDD:395001 39/52 (75%)
hoxa4aNP_571610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..99 4/13 (31%)
Antp-type hexapeptide 126..131 4/14 (29%)
Homeobox 150..203 CDD:278475 39/52 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..245 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.