DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubx and hoxc9a

DIOPT Version :10

Sequence 1:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_571603.3 Gene:hoxc9a / 58043 ZFINID:ZDB-GENE-000328-5 Length:270 Species:Danio rerio


Alignment Length:80 Identity:46/80 - (57%)
Similarity:57/80 - (71%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 DWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLK 351
            :|:.....|:: |..||:||||||||||..|.||||.||.|:|..|.|||||:||||||||||:|
Zfish   195 NWIHARSTRKK-RCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMK 258

  Fly   352 KEIQAIKELNEQEKQ 366
            |   ..||.|:.::|
Zfish   259 K---MNKEKNDSKEQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UbxNP_536752.1 Homeodomain 296..352 CDD:459649 38/55 (69%)
hoxc9aNP_571603.3 Hox9_act 11..189 CDD:461369
Homeodomain 203..251 CDD:459649 32/48 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.